Route de 306 Xinsha, rue de Shajing, secteur de Bao'an, Shenzhen, Guangdong, Chine
Maison ProduitsStéroïdes de peptide

Hormone Sermorelin 2mg CAS 86168-78-7 de polypeptide pour l'utilisation diagnostique d'agent

Hormone Sermorelin 2mg CAS 86168-78-7 de polypeptide pour l'utilisation diagnostique d'agent

    • Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage
    • Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage
  • Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage

    Détails sur le produit:

    Lieu d'origine: La Chine
    Nom de marque: Sendi
    Certification: +8618578209860
    Numéro de modèle: ycwlb045@yccreate.com

    Conditions de paiement et expédition:

    Quantité de commande min: 10vials
    Prix: USD1-10/vial
    Détails d'emballage: Emballage discret
    Délai de livraison: 5-7 jours à votre porte
    Conditions de paiement: Virement bancaire, Western Union, Bitcoin.
    Capacité d'approvisionnement: 50000000vials/month
    Contactez maintenant
    Description de produit détaillée
    CAS: 86168-78-7 MF: C149H246N44O42S
    mw: 3357,88 Spécification: 2mg
    Délai de livraison: Dans les 24 heures d'emballage: Paquet caché
    Paiement: Bank/WU/Bitcoin whatsapp: +8618578209860

    Hormone Sermorelin 2mg CAS 86168-78-7 de polypeptide pour l'utilisation diagnostique d'agent

    Nom de produit : Sermorelin
    Synonymes : SERMORELIN ; ACÉTATE DE SERMORELIN ; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 ; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 ; HUMAIN TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 ; H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 ; FACTEUR DE LIBÉRATION D'HORMONE DE CROISSANCE (1-29), AMIDE, HUMAINE ; AMIDE DE GRF (1-29) (HUMAINE)
    CAS : 86168-78-7
    MF : C149H246N44O42S
    MW : 3357,88
    Inhibiteur d'oxydase de xanthine d'utilisation

    Profils de Sermorelin

    L'acétate de Sermorelin, également connu sous le nom de GRF 1-29, est une hormone de croissance sortant l'hormone (GHRH) produit par le cerveau qui stimule la production et la version de l'hormone de croissance (GH). L'acétate de Sermorelin a été développé pendant les années 70, qui est vraisemblablement le plus court entièrement - fragment fonctionnel de GHRH et a été employé la première fois comme essai pour la sécrétion d'hormone de croissance. Il est employé souvent intensivement dans la thérapie anti-vieillissement avec la testostérone chez les hommes. L'acétate de Sermorelin affecte une source plus primaire d'échec à l'axe neuroendocrine de GH, a une activité plus physiologique, et son utilisation pour l'insuffisance adulte d'hormone n'est pas restreinte. Comparé à l'hormone de croissance humaine (hGH), l'acétate de Sermorelin est un secretagogue d'hormone de croissance, ainsi il signifie qu'il stimule la glande pituitaire produire et sécréter l'hormone de croissance. En outre, l'acétate et le GRF modifié 1-29 de Sermorelin contient 29 acides aminés tandis que le hGH est une plus grande molécule contenant 191 acides aminés.

    Le peptide d'acétate de Sermorelin et le HGH

    L'acétate de Sermorelin, qui partage la structure semblable à CJC-1295, est une hormone synthétique bio-identique qui est extrêmement efficace en augmentant la quantité de HGH. L'hormone de croissance humaine est une hormone libérée par le corps qui commande la reproduction et la croissance des cellules et de chacune des organes dans le corps. À un jeune âge, la production du HGH du corps est la plus en activité tandis que le taux de croissance est à son point plus élevé. Après l'âge de 30, pour chaque décennie de la vie, il y a une réduction de 14% de production de HGH. Par l'âge de 40, la production de HGH est environ 40 pour cent de ce qu'était il à l'âge de 20. Avec le développement ultérieur de l'hormone de croissance sortant des facteurs (GHRF), tel que GRF modifié 1-29, la production de HGH peut probablement commencer encore en stimulant la glande pituitaire.

     

    Série de peptides :

     

    Peptides
    MGF, 2mg
    MGF de CHEVILLE, 2mg
    CJC-1295 DAC, 2mg
    CJC-1295, 2mg
    PT141, 10mg
    Melanotan-2, 10mg
    GHRP-2, 10mg
    GHRP-6, 10mg
    GHRP-2, 5mg
    GHRP-6, 5mg
    Ipamorelin, 2mg
    Hexarelin, 2mg
    Sermorelin, 2mg
    Oxytocine, 2mg
    TB500, 2mg
    HGH 176-191, 2mg
    Triptorelin, 2mg
    Tesamorelin, 2mg
    Gonadorelin, 2mg
    Gonadorelin, 10mg
    DSIP, 2mg
    Selank, 5mg
    BPC 157, 2mg
    Epitalon, 10mg
    Follistatin 344, 1mg
    AOD-9604, 2mg
    Deslorelin, 20mg

     

    Hormone Sermorelin 2mg CAS 86168-78-7 de polypeptide pour l'utilisation diagnostique d'agent 

    Coordonnées
    Shenzhen Sendi Biotechnology Co.Ltd.

    Personne à contacter: Ivy Young

    Envoyez votre demande directement à nous (0 / 3000)

    Autres Produits